- LASS1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92067
- This antibody was developed against Recombinant Protein corresponding to amino acids: VLTGQVHELK DLREYDTAEA QSLKPSKAEK PLRNGLVKDK RF
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- Human
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- EPM8, GDF-1, GDF1, LAG1, LASS1, UOG1
- LASS1
- ceramide synthase 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
Specifications/Features
Available conjugates: Unconjugated